Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G265200.1.p
Common NameGlyma09g40130.1, LOC100783614
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 821aa    MW: 89611.7 Da    PI: 6.3731
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G265200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++eLe+lF+++++p++++r eL+++l+L++rqVk+WFqNrR+++k
                          688999***********************************************999 PP

                START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          ela++a++elvk+a+ +ep+W +s     e++n de+++++++  +     + +ea+r +g+v+ ++  lve+l+d++ +W+e+++    
                          5899*************************************999989***9***************************.*********** PP

                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          + +t evis+g      galqlm aelq+lsplvp R++ f+R+++q+ +g w++vdvS+d  ++ +  + +v +++lpSg+++++++ng
                          *****************************************************************999********************** PP

                START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          +skvtwveh++++++++h+l+r+l++sg+ +ga++wvatlqrqce+
                          ********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.783116176IPR001356Homeobox domain
SMARTSM003892.4E-19117180IPR001356Homeobox domain
CDDcd000861.51E-19118176No hitNo description
PfamPF000461.1E-18119174IPR001356Homeobox domain
PROSITE patternPS000270151174IPR017970Homeobox, conserved site
PROSITE profilePS5084845.48327563IPR002913START domain
SuperFamilySSF559612.2E-35329560No hitNo description
CDDcd088756.82E-126331559No hitNo description
SMARTSM002345.6E-48336560IPR002913START domain
PfamPF018526.8E-57336560IPR002913START domain
SuperFamilySSF559611.81E-24588813No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 821 aa     Download sequence    Send to blast
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311660.0KT031166.1 Glycine max clone HN_CCL_121 homeodomain/HOMEOBOX transcription factor (Glyma09g40130.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006587870.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
RefseqXP_003534596.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A0K2CTQ20.0A0A0K2CTQ2_SOYBN; Homeodomain/HOMEOBOX transcription factor (Fragment)
TrEMBLI1L6R20.0I1L6R2_SOYBN; Uncharacterized protein
STRINGGLYMA09G40130.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Chai C, et al.
    Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance.
    BMC Genomics, 2015. 16: p. 596